PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009621431.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 347aa    MW: 39521.6 Da    PI: 8.7185
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009621431.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.26e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +l+ +++++G g+W++ +++  + R++k+c++rw +yl
   XP_009621431.1 14 KGPWTPEEDRKLLSCIEEHGCGSWRALPAKADLQRCGKSCRLRWINYL 61
                     79********************************************97 PP

2Myb_DNA-binding47.63.7e-1567110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++ +E+  +++++++lG++ W++Ia++++  Rt++++k++w++
   XP_009621431.1  67 RGKFSLQEERTIIQLHALLGNR-WSAIAAYLP-SRTDNEIKNYWNS 110
                      89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.891961IPR017930Myb domain
SuperFamilySSF466891.07E-2911108IPR009057Homeodomain-like
SMARTSM007172.4E-111363IPR001005SANT/Myb domain
PfamPF002494.3E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.0E-241568IPR009057Homeodomain-like
CDDcd001673.64E-101661No hitNo description
PROSITE profilePS5129424.27162116IPR017930Myb domain
SMARTSM007172.3E-1566114IPR001005SANT/Myb domain
PfamPF002491.3E-1467110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-2569116IPR009057Homeodomain-like
CDDcd001672.79E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MGRSKCCDKQ GLKKGPWTPE EDRKLLSCIE EHGCGSWRAL PAKADLQRCG KSCRLRWINY  60
LRPDIKRGKF SLQEERTIIQ LHALLGNRWS AIAAYLPSRT DNEIKNYWNS RLKKRLTKMG  120
IDPMTHKPKI TNNINGSSND QSKYVANLSH MAEWESARLE AEARLVRRSK DHSKYLFNST  180
RNNNNKNNNY VVSQPYYQLP CLDILKAWQR ASTKLPTTND ISSILLDGFA NKNLESSIPS  240
TLNSSENLFV NNVPCITKVG DQNLPLSTIT CLENPCPTKD VQTDLPSFMQ EFSELFDPEY  300
TQNSANNFSG IQVDNFMGSC SGDFEDNKFN WNNFPYLVTS PIGSPVF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009621431.10.0PREDICTED: protein ODORANT1-like
TrEMBLM1BKS81e-173M1BKS8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000474461e-172(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.13e-80myb domain protein 16